====== Isoniazid 100μM R08 exp494 ======
==== Mechanism of Action ====
Inhibits fatty acid synthases, pro-drug activated by catalase-peroxidase KatG
  * **<color #00a2e8>Class / Subclass 1:</color>** Infectious Disease / Antibiotic




==== Technical Notes ====
<accordion collapsed='true'>
<panel title='Protein References' collapsed='true'>
    * **<color #00a2e8>PubChem Name:</color>** %%Isoniazid%%
    * **<color #00a2e8>Synonyms:</color>** INH; Isonicotinic acid hydrazide; Isonicotinic hydrazide
    * **<color #00a2e8>CAS #:</color>** 54-85-3
    * **<color #00a2e8>PubChem CID:</color>** [[https://pubchem.ncbi.nlm.nih.gov/compound/3767|3767]]
    * **<color #00a2e8>IUPAC:</color>** %%pyridine-4-carbohydrazide%%
    * **<color #00a2e8>INCHI Name:</color>** InChI=1S/C6H7N3O/c7-9-6(10)5-1-3-8-4-2-5/h1-4H,7H2,(H,9,10)
    * **<color #00a2e8>INCHI Key:</color>** QRXWMOHMRWLFEY-UHFFFAOYSA-N
    * **<color #00a2e8>Molecular Weight:</color>** 137.14
    * **<color #00a2e8>Canonical SMILES:</color>** C1=CN=CC=C1C(=O)NN
    * **<color #00a2e8>Isomeric SMILES:</color>** N/A
    * **<color #00a2e8>Molecular Formula:</color>** RPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRR
{{:chemogenomics:structures:chem-0302.svg?nolink}}
</panel>


<panel title='Protein Supplier' collapsed='true'>
    * **<color #00a2e8>Supplier Name:</color>** Combi-Blocks
    * **<color #00a2e8>Catalog #:</color>** QE-0718
    * **<color #00a2e8>Lot #:</color>** B14776
</panel>


<panel title='Protein Characterization' collapsed='true'>
    * **<color #00a2e8>HRMS (ESI-TOF) m/z:</color>** (M+H)+ Calcd for C6H7N3O 138.06619; found 138.06497
</panel>


<panel title='Dose Response Curve' collapsed='true'>
    * **<color #00a2e8>Platform ID:</color>** Isoniazid
    * **<color #00a2e8>Min:</color>** -6.5476; **<color #00a2e8>Max:</color>** 43.9660
{{:chemogenomics:dose_response:dr_549.png?nolink&500 |}}
\\ 
\\ 
\\ 
\\ 
|< 300px 100px 200px >|
^ IC   ^ Concentration (µM) ^
| IC10  |N/A    |
| IC20  |N/A    |
| IC30  |N/A    |
| IC40  |N/A    |
| IC50  |N/A    |
| IC60  |N/A    |
| IC70  |N/A    |
| IC80  |N/A    |
| IC90  |N/A    |
\\ 
</panel>
</accordion>
==== Screen Summary ====
    * **<color #00a2e8>Round</color>**: 08
    * **<color #00a2e8>Dose</color>**: 100µM
    * **<color #00a2e8>Days of incubation</color>**: 8
    * **<color #00a2e8>Doublings</color>**: 7.0
    * **<color #00a2e8>Numbers of reads</color>**: 17785019


==== Screen Results ====


^Sensitive/Resistant hits (FDR<0.05)^CRANKS^Score Plot^Top 30 Genes^Screen Similarity^Top 30 Sensitive GO terms^Top 30 Resistant GO terms^
|0/0|<color #e85500>[[https://files.tyerslab.com/files/public/chemogenomics/cranks/Isoniazid_100uM_Round-8_exp494.txt|Scores]]</color>|<button type="primary" size="sm" modal="ScorePlot">View</button>|<button type="primary" size="sm" modal="modal_hits">View</button>|<button type="default" size="sm" modal="modal_screen_similarity">View</button>|<button type="default" size="sm" modal="modal_go_sensitive">View</button>|<button type="default" size="sm" modal="modal_go_resistant">View</button>|
<modal id='ScorePlot' size='lg' title='Isoniazid 100μM R08 exp494'>
{{:chemogenomics:cranks_plots:exp494.png?nolink}}
</modal>


<modal id="modal_hits" size="sm" title="Top 30 S/R Genes">
^Gene^CRANKS Score^FDR^
|[[:human_genes:K:KCNH8|KCNH8]]|-2.46|0.54|
|[[:human_genes:N:NOC3L|NOC3L]]|-2.42|0.64|
|[[:human_genes:C:CPNE1|CPNE1]]|-2.31|0.54|
|[[:human_genes:C:CEP164|CEP164]]|-2.29|0.54|
|[[:human_genes:C:CETN1|CETN1]]|-2.28|0.54|
|[[:human_genes:E:EPT1|EPT1]]|-2.20|0.54|
|[[:human_genes:A:ANXA11|ANXA11]]|-2.18|0.54|
|[[:human_genes:U:USP19|USP19]]|-2.14|0.54|
|[[:human_genes:S:SLC30A5|SLC30A5]]|-2.13|0.54|
|[[:human_genes:T:TBCA|TBCA]]|-2.09|0.54|
|[[:human_genes:G:GEMIN8|GEMIN8]]|-2.05|0.67|
|[[:human_genes:A:ATP5J|ATP5J]]|-2.03|0.54|
|[[:human_genes:D:DDOST|DDOST]]|-2.01|0.71|
|[[:human_genes:P:P2RY2|P2RY2]]|-1.99|0.54|
|[[:human_genes:C:C2orf53|C2orf53]]|-1.98|0.54|
|[[:human_genes:A:ASB3|ASB3]]|-1.97|0.58|
|[[:human_genes:U:UBE2U|UBE2U]]|-1.97|0.54|
|[[:human_genes:P:PGBD4|PGBD4]]|-1.95|0.54|
|[[:human_genes:D:DKC1|DKC1]]|-1.95|0.92|
|[[:human_genes:Z:ZNF732|ZNF732]]|-1.93|0.54|
|[[:human_genes:S:SLC35A4|SLC35A4]]|-1.93|0.54|
|[[:human_genes:T:TNFRSF10D|TNFRSF10D]]|-1.92|0.54|
|[[:human_genes:A:ACTRT3|ACTRT3]]|-1.91|0.54|
|[[:human_genes:W:WDR59|WDR59]]|-1.91|0.54|
|[[:human_genes:Z:ZSCAN23|ZSCAN23]]|-1.90|0.54|
|[[:human_genes:A:ARNT2|ARNT2]]|-1.90|0.54|
|[[:human_genes:A:ADPRM|ADPRM]]|-1.90|0.54|
|[[:human_genes:T:TCAF2|TCAF2]]|-1.89|0.72|
|[[:human_genes:M:MIR205HG|MIR205HG]]|-1.88|0.92|
|[[:human_genes:O:ODC1|ODC1]]|-1.87|0.58|
|[[:human_genes:P:POLA2|POLA2]]|1.82|0.94|
|[[:human_genes:S:STARD3|STARD3]]|1.83|0.94|
|[[:human_genes:C:CTNNBIP1|CTNNBIP1]]|1.84|0.85|
|[[:human_genes:K:KCNQ4|KCNQ4]]|1.87|0.85|
|[[:human_genes:G:GABRB3|GABRB3]]|1.88|0.85|
|[[:human_genes:U:USP17L13|USP17L13]]|1.89|0.85|
|[[:human_genes:A:ATXN2L|ATXN2L]]|1.89|0.85|
|[[:human_genes:R:RPL8|RPL8]]|1.90|0.94|
|[[:human_genes:L:LOC441155|LOC441155]]|1.90|0.85|
|[[:human_genes:F:F2R|F2R]]|1.91|0.85|
|[[:human_genes:P:PER1|PER1]]|1.92|0.85|
|[[:human_genes:M:MYH13|MYH13]]|1.93|0.85|
|[[:human_genes:G:GZMB|GZMB]]|1.93|0.85|
|[[:human_genes:S:SPCS1|SPCS1]]|1.93|0.85|
|[[:human_genes:N:NIPBL|NIPBL]]|1.95|0.94|
|[[:human_genes:D:DDX39B|DDX39B]]|1.96|0.85|
|[[:human_genes:N:NRL|NRL]]|1.97|0.85|
|[[:human_genes:C:CENPV|CENPV]]|2.02|0.85|
|[[:human_genes:D:DIEXF|DIEXF]]|2.03|0.88|
|[[:human_genes:S:SRRT|SRRT]]|2.06|0.85|
|[[:human_genes:S:SRGAP2B|SRGAP2B]]|2.09|0.85|
|[[:human_genes:F:FAM96A|FAM96A]]|2.13|0.85|
|[[:human_genes:N:NUP93|NUP93]]|2.13|0.85|
|[[:human_genes:P:POLE|POLE]]|2.14|0.94|
|[[:human_genes:N:NUDCD1|NUDCD1]]|2.15|0.85|
|[[:human_genes:W:WEE1|WEE1]]|2.22|0.86|
|[[:human_genes:C:CFHR5|CFHR5]]|2.25|0.85|
|[[:human_genes:N:NOTCH2NL|NOTCH2NL]]|2.35|0.85|
|[[:human_genes:S:SRGAP2C|SRGAP2C]]|2.51|0.85|
|[[:human_genes:U:USP17L17|USP17L17]]|3.14|0.85|
</modal>


<modal id="modal_screen_similarity" size="lg" title="Correlated Screens">
No correlation data above threshold. (correlation > 0.05)
</modal>


<modal id="modal_go_sensitive" size="lg" title="Top 30 sensitive GO terms">No GO term hits below threshold. (FDR <0.05)</modal>
<modal id="modal_go_resistant" size="lg" title="Top 30 resistant GO terms">No GO term hits below threshold. (FDR <0.05)</modal>