IL-3 9ng/ml R08 exp493 [The Human Chemical-Genetic Interaction Map Project]

This page is read only. You can view the source, but not change it. Ask your administrator if you think this is wrong.
====== IL-3 9ng/ml R08 exp493 ======
==== Mechanism of Action ====
Ligand for IL3RA receptor, induces myeloid lineage proliferation and differentiation
  * **<color #00a2e8>Class / Subclass 1:</color>** Signal Transduction / Receptor Ligand




==== Technical Notes ====
<accordion collapsed='true'>
<panel title='Compound References' collapsed='true'>
    * **<color #00a2e8>PubChem Name:</color>** %%N/A%%
    * **<color #00a2e8>Synonyms:</color>** N/A
    * **<color #00a2e8>CAS #:</color>** N/A
    * **<color #00a2e8>PubChem CID:</color>** N/A
    * **<color #00a2e8>IUPAC:</color>** %%N/A%%
    * **<color #00a2e8>INCHI Name:</color>** N/A
    * **<color #00a2e8>INCHI Key:</color>** N/A
    * **<color #00a2e8>Molecular Weight:</color>** 22kDa
    * **<color #00a2e8>Canonical SMILES:</color>** N/A
    * **<color #00a2e8>Isomeric SMILES:</color>** N/A
    * **<color #00a2e8>Molecular Formula:</color>** APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLR
{{:chemogenomics:structures:chem-0301.svg?nolink}}
</panel>


<panel title='Compound Supplier' collapsed='true'>
    * **<color #00a2e8>Supplier Name:</color>** Cusabio
    * **<color #00a2e8>Catalog #:</color>** CSB-AP001701HU
    * **<color #00a2e8>Lot #:</color>** 03962
</panel>


<panel title='Compound Characterization' collapsed='true'>
Characterization data not available.
</panel>


<panel title='Dose Response Curve' collapsed='true'>
    * **<color #00a2e8>Platform ID:</color>** IL_3
    * **<color #00a2e8>Min:</color>** -24.0681; **<color #00a2e8>Max:</color>** 5.3009
{{:chemogenomics:dose_response:dr_548.png?nolink&500 |}}
\\ 
\\ 
\\ 
\\ 
|< 300px 100px 200px >|
^ IC   ^ Concentration (µM) ^
| IC10  |N/A    |
| IC20  |N/A    |
| IC30  |N/A    |
| IC40  |N/A    |
| IC50  |N/A    |
| IC60  |N/A    |
| IC70  |N/A    |
| IC80  |N/A    |
| IC90  |N/A    |
\\ 
</panel>
</accordion>
==== Screen Summary ====
    * **<color #00a2e8>Round</color>**: 08
    * **<color #00a2e8>Dose</color>**: 9ng/mL
    * **<color #00a2e8>Days of incubation</color>**: 8
    * **<color #00a2e8>Doublings</color>**: 6.9
    * **<color #00a2e8>Numbers of reads</color>**: 18305686


==== Screen Results ====


^Sensitive/Resistant hits (FDR<0.05)^CRANKS^Score Plot^Top 30 Genes^Screen Similarity^Top 30 Sensitive GO terms^Top 30 Resistant GO terms^
|0/0|<color #e85500>[[https://files.tyerslab.com/files/public/chemogenomics/cranks/IL-3_9_ng_per_mL_Round-8_exp493.txt|Scores]]</color>|<button type="primary" size="sm" modal="ScorePlot">View</button>|<button type="primary" size="sm" modal="modal_hits">View</button>|<button type="default" size="sm" modal="modal_screen_similarity">View</button>|<button type="default" size="sm" modal="modal_go_sensitive">View</button>|<button type="default" size="sm" modal="modal_go_resistant">View</button>|
<modal id='ScorePlot' size='lg' title='IL-3 9ng/ml R08 exp493'>
{{:chemogenomics:cranks_plots:exp493.png?nolink}}
</modal>


<modal id="modal_hits" size="sm" title="Top 30 S/R Genes">
^Gene^CRANKS Score^FDR^
|[[:human_genes:A:ATIC|ATIC]]|-2.62|0.16|
|[[:human_genes:D:DPAGT1|DPAGT1]]|-2.54|0.19|
|[[:human_genes:S:SCEL|SCEL]]|-2.49|0.16|
|[[:human_genes:Z:ZNF431|ZNF431]]|-2.48|0.35|
|[[:human_genes:I:IRX4|IRX4]]|-2.45|0.16|
|[[:human_genes:C:CMC2|CMC2]]|-2.34|0.57|
|[[:human_genes:T:TSPAN10|TSPAN10]]|-2.24|0.57|
|[[:human_genes:R:RPE|RPE]]|-2.23|0.38|
|[[:human_genes:C:C2CD4C|C2CD4C]]|-2.20|0.35|
|[[:human_genes:T:TREML1|TREML1]]|-2.19|0.39|
|[[:human_genes:N:NEFM|NEFM]]|-2.18|0.39|
|[[:human_genes:C:CP|CP]]|-2.18|0.35|
|[[:human_genes:A:ABCB11|ABCB11]]|-2.15|0.37|
|[[:human_genes:T:TMC5|TMC5]]|-2.11|0.38|
|[[:human_genes:R:RUVBL1|RUVBL1]]|-2.10|0.78|
|[[:human_genes:A:ADAMTS6|ADAMTS6]]|-2.09|0.38|
|[[:human_genes:F:FGF19|FGF19]]|-2.07|0.47|
|[[:human_genes:G:GALNT1|GALNT1]]|-2.04|0.39|
|[[:human_genes:V:VEZT|VEZT]]|-2.03|0.39|
|[[:human_genes:U:USF1|USF1]]|-2.00|0.41|
|[[:human_genes:C:CEPT1|CEPT1]]|-1.99|0.41|
|[[:human_genes:N:NR1D2|NR1D2]]|-1.99|0.41|
|[[:human_genes:T:TP53BP1|TP53BP1]]|-1.95|0.57|
|[[:human_genes:B:BNC1|BNC1]]|-1.94|0.47|
|[[:human_genes:C:CHKA|CHKA]]|-1.93|0.47|
|[[:human_genes:V:VPS25|VPS25]]|-1.93|0.86|
|[[:human_genes:H:HDAC3|HDAC3]]|-1.92|0.47|
|[[:human_genes:U:UBXN2B|UBXN2B]]|-1.92|0.47|
|[[:human_genes:G:GTF3C2|GTF3C2]]|-1.91|0.59|
|[[:human_genes:G:GTF3C6|GTF3C6]]|-1.88|0.57|
|[[:human_genes:P:PSMD3|PSMD3]]|1.94|0.83|
|[[:human_genes:R:RFC1|RFC1]]|1.94|0.68|
|[[:human_genes:C:CEP95|CEP95]]|1.95|0.47|
|[[:human_genes:A:ATG9A|ATG9A]]|1.95|0.48|
|[[:human_genes:F:FRMPD4|FRMPD4]]|1.95|0.47|
|[[:human_genes:F:FAU|FAU]]|1.95|0.68|
|[[:human_genes:C:CDAN1|CDAN1]]|1.96|0.68|
|[[:human_genes:E:ELK4|ELK4]]|1.97|0.47|
|[[:human_genes:S:SCGB1D2|SCGB1D2]]|1.97|0.47|
|[[:human_genes:P:PELP1|PELP1]]|1.97|0.67|
|[[:human_genes:U:UBE2I|UBE2I]]|1.98|0.47|
|[[:human_genes:T:TRAIP|TRAIP]]|1.99|0.74|
|[[:human_genes:Z:ZNF425|ZNF425]]|1.99|0.47|
|[[:human_genes:N:NUP88|NUP88]]|2.00|0.47|
|[[:human_genes:P:PSMD14|PSMD14]]|2.02|0.83|
|[[:human_genes:S:SLC28A3|SLC28A3]]|2.04|0.47|
|[[:human_genes:H:HSF2|HSF2]]|2.04|0.47|
|[[:human_genes:P:POLE|POLE]]|2.05|0.71|
|[[:human_genes:L:LMBR1L|LMBR1L]]|2.08|0.47|
|[[:human_genes:S:SARS|SARS]]|2.11|0.83|
|[[:human_genes:Z:ZNF569|ZNF569]]|2.12|0.47|
|[[:human_genes:C:CDKN1B|CDKN1B]]|2.13|0.47|
|[[:human_genes:C:C11orf87|C11orf87]]|2.13|0.47|
|[[:human_genes:V:VPS16|VPS16]]|2.15|0.47|
|[[:human_genes:C:CAMKV|CAMKV]]|2.17|0.47|
|[[:human_genes:C:CCDC64|CCDC64]]|2.18|0.47|
|[[:human_genes:M:MPHOSPH10|MPHOSPH10]]|2.19|0.50|
|[[:human_genes:Z:ZNF709|ZNF709]]|2.22|0.47|
|[[:human_genes:N:NR1H4|NR1H4]]|2.36|0.46|
|[[:human_genes:C:CDK2|CDK2]]|2.56|0.28|
</modal>


<modal id="modal_screen_similarity" size="lg" title="Correlated Screens">
No correlation data above threshold. (correlation > 0.05)
</modal>


<modal id="modal_go_sensitive" size="lg" title="Top 30 sensitive GO terms">No GO term hits below threshold. (FDR <0.05)</modal>
<modal id="modal_go_resistant" size="lg" title="Top 30 resistant GO terms">No GO term hits below threshold. (FDR <0.05)</modal>