IL-3 9ng/ml R08 exp493

Ligand for IL3RA receptor, induces myeloid lineage proliferation and differentiation

  • Class / Subclass 1: Signal Transduction / Receptor Ligand

Compound References

  • PubChem Name: N/A
  • Synonyms: N/A
  • CAS #: N/A
  • PubChem CID: N/A
  • IUPAC: N/A
  • INCHI Name: N/A
  • INCHI Key: N/A
  • Molecular Weight: 22kDa
  • Canonical SMILES: N/A
  • Isomeric SMILES: N/A
  • Molecular Formula: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLR

Compound Supplier

  • Supplier Name: Cusabio
  • Catalog #: CSB-AP001701HU
  • Lot #: 03962

Compound Characterization

Characterization data not available.

Dose Response Curve

  • Platform ID: IL_3
  • Min: -24.0681; Max: 5.3009





IC Concentration (µM)
IC10 N/A
IC20 N/A
IC30 N/A
IC40 N/A
IC50 N/A
IC60 N/A
IC70 N/A
IC80 N/A
IC90 N/A


  • Round: 08
  • Dose: 9ng/mL
  • Days of incubation: 8
  • Doublings: 6.9
  • Numbers of reads: 18305686
Sensitive/Resistant hits (FDR<0.05)CRANKSScore PlotTop 30 GenesScreen SimilarityTop 30 Sensitive GO termsTop 30 Resistant GO terms
0/0ScoresViewViewViewViewView

  • Last modified: 2026/01/15 21:36
  • by 127.0.0.1