IL-3 9ng/ml R08 exp493
Mechanism of Action
Ligand for IL3RA receptor, induces myeloid lineage proliferation and differentiation
- Class / Subclass 1: Signal Transduction / Receptor Ligand
Technical Notes
Protein References
- PubChem Name: N/A
- Synonyms: N/A
- CAS #: N/A
- PubChem CID: N/A
- IUPAC: N/A
- INCHI Name: N/A
- INCHI Key: N/A
- Molecular Weight: 22kDa
- Canonical SMILES: N/A
- Isomeric SMILES: N/A
- Molecular Formula: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLR
Protein Supplier
- Supplier Name: Cusabio
- Catalog #: CSB-AP001701HU
- Lot #: 03962
Protein Characterization
Characterization data not available.
Dose Response Curve
- Platform ID: IL_3
- Min: -24.0681; Max: 5.3009
| IC | Concentration (µM) |
|---|---|
| IC10 | N/A |
| IC20 | N/A |
| IC30 | N/A |
| IC40 | N/A |
| IC50 | N/A |
| IC60 | N/A |
| IC70 | N/A |
| IC80 | N/A |
| IC90 | N/A |
Screen Summary
- Round: 08
- Dose: 9ng/mL
- Days of incubation: 8
- Doublings: 6.9
- Numbers of reads: 18305686
Screen Results
| Sensitive/Resistant hits (FDR<0.05) | CRANKS | Score Plot | Top 30 Genes | Screen Similarity | Top 30 Sensitive GO terms | Top 30 Resistant GO terms |
|---|---|---|---|---|---|---|
| 0/0 | Scores |