Isoniazid 100μM R08 exp494
Mechanism of Action
Inhibits fatty acid synthases, pro-drug activated by catalase-peroxidase KatG
- Class / Subclass 1: Infectious Disease / Antibiotic
Technical Notes
Protein References
- PubChem Name: Isoniazid
- Synonyms: INH; Isonicotinic acid hydrazide; Isonicotinic hydrazide
- CAS #: 54-85-3
- PubChem CID: 3767
- IUPAC: pyridine-4-carbohydrazide
- INCHI Name: InChI=1S/C6H7N3O/c7-9-6(10)5-1-3-8-4-2-5/h1-4H,7H2,(H,9,10)
- INCHI Key: QRXWMOHMRWLFEY-UHFFFAOYSA-N
- Molecular Weight: 137.14
- Canonical SMILES: C1=CN=CC=C1C(=O)NN
- Isomeric SMILES: N/A
- Molecular Formula: RPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRR
Protein Supplier
- Supplier Name: Combi-Blocks
- Catalog #: QE-0718
- Lot #: B14776
Protein Characterization
- HRMS (ESI-TOF) m/z: (M+H)+ Calcd for C6H7N3O 138.06619; found 138.06497
Dose Response Curve
- Platform ID: Isoniazid
- Min: -6.5476; Max: 43.9660
| IC | Concentration (µM) |
|---|---|
| IC10 | N/A |
| IC20 | N/A |
| IC30 | N/A |
| IC40 | N/A |
| IC50 | N/A |
| IC60 | N/A |
| IC70 | N/A |
| IC80 | N/A |
| IC90 | N/A |
Screen Summary
- Round: 08
- Dose: 100µM
- Days of incubation: 8
- Doublings: 7.0
- Numbers of reads: 17785019
Screen Results
| Sensitive/Resistant hits (FDR<0.05) | CRANKS | Score Plot | Top 30 Genes | Screen Similarity | Top 30 Sensitive GO terms | Top 30 Resistant GO terms |
|---|---|---|---|---|---|---|
| 0/0 | Scores |